ABflo[R] 488 Rabbit anti-Human CD335/NKp46 monoclonal antibody

Size

POA

SKU:: A24624
Additional Names:: CD335|LY94|natural cytotoxicity triggering receptor 1|NCR1|NK-p46|NKP46
Application:: Flow Cytometry, IF, ICC
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQ
Uniprot:: O76036
Synonyms:: CD335;LY94;Lymphocyte antigen 94 homolog;lymphocyte antigen 94 homolog (activating NK-receptor; NK-p46);natural cytotoxicity triggering receptor 1;natural killer cell p46-related protein;NK cell-activating receptor;NK-p46;NKP46
Extra Details:: The natural cytotoxic receptor (NCR) family includes NCR1 (NKp46/CD335), NCR2 (NKp44/CD336), and NCR3 (NKp30/CD337). They are type I single Transmembrane protein belonging to the immunoglobulin (Ig) superfamily. Various pathogenic and host coding molecules have been identified as ligands for NCR. They were initially discovered through their ability to induce cytotoxicity of natural killer (NK) cells to tumor cells in vitro, and animal models have shown that NCR plays a role in tumor monitoring, viral infection, and pregnancy in vivo. NCR1/NKP46 is considered a universal marker of NK cells, and recent studies have found that it is also expressed by other cells, such as the first group of natural lymphocytes (ILC1), a subgroup of the third group of ILC (NCR+ILC3), and G GammaD Delta T cells. NCR1/NKp46 is also expressed in some malignant NK cells, natural killer T (NKT) cells and T-cell lymphoma, and is considered as a diagnostic marker and therapeutic target for them. The cross-linking of NCR1/NKp46 with antibodies can activate NK cells, which has been studied as a promising therapeutic pathway.

Shipping Conditions:: Blue Ice