IL22 Rabbit monoclonal antibody

Size

POA

SKU:: A24612
Additional Names:: IL-21|IL-22|IL-D110|IL-TIF|IL22|ILTIF|TIFa|TIFIL-23|zcyto18
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 16 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Uniprot:: Q9GZX6
Synonyms:: cytokine Zcyto18;IL-10-related T-cell-derived inducible factor;IL-10-related T-cell-derived-inducible factor;IL-21;IL-22;IL-D110;IL-TIF;ILTIF;interleukin-22;TIFa;TIFIL-23;zcyto18
Extra Details:: This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2).