Mouse PlGF Rabbit polyclonal antibody

Size

£152.00

SKU:: A24547
Additional Names:: Mouse PlGF|PIGF|Plgf
Application:: ELISA, WB
Molecular Weight:: 22kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Uniprot:: P49764
Synonyms:: AI854365;PI;PIGF;PL;placenta growth factor;Plgf
Extra Details:: Predicted to enable identical protein binding activity; receptor ligand activity; and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain; gut gland; musculature; reproductive system; and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor).