B7-H4 / B7S1 / B7x Rabbit polyclonal antibody

Size

£152.00

SKU:: A24542
Additional Names:: B7-H4|B7-H4 / B7S1 / B7x|B7h.5|B7H4|B7S1|B7X|PRO1291|V-set domain-containing T-cell activation inhibitor 1|VCTN1|VTCN1
Application:: ELISA, WB
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAS
Uniprot:: Q7Z7D3
Synonyms:: B7 family member, H4;B7 homolog 4;B7 superfamily member 1;B7-H4;B7h.5;B7H4;B7S1;B7X;immune costimulatory protein B7-H4;PRO1291;Protein B7S1;T cell costimulatory molecule B7x;T-cell costimulatory molecule B7x;V-set domain-containing T-cell activation inhibitor 1;VCTN1
Extra Details:: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice