A24527
CD53 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24527
- Additional Names:
- CD53|Ox-44|Tspan25
- Application:
- ELISA, WB
- Molecular Weight:
- 35-45kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
- Uniprot:
- Q61451
- Synonyms:
- AI323659;cell surface glycoprotein CD53;leukocyte surface antigen CD53;Ox-4;Ox-44;Tsp;Tspan25
- Extra Details:
- Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Orthologous to human CD53 (CD53 molecule).
- Shipping Conditions:
- Blue Ice

