A24525
CD132 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24525
- Additional Names:
- [g]c|CD132|gamma(c)|gc|p64
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA
- Uniprot:
- P34902
- Synonyms:
- [g]c;CD132;common gamma chain;cytokine receptor common subunit gamma;gamm;gamma C receptor;gamma(;gamma(c);gammaC;gc;IL-2 receptor subunit gamma;IL-2R subunit gamma;interleukin-2 receptor subunit gamma;p64
- Extra Details:
- This gene encodes a transmembrane protein that is a common subunit of several interleukin receptor complexes. These receptors are comprised of alpha and beta subunits in addition to this gamma subunit. Signalling through this pathway in important in immune cell differentiation and function. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice