A24516
POLE4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24516
- Additional Names:
- DNA polymerase epsilon subunit 4|p12|POLE4|YHHQ1
- Application:
- ELISA, WB
- Molecular Weight:
- 15kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLD
- Uniprot:
- Q9NR33
- Synonyms:
- DNA polymerase epsilon subunit 4;DNA polymerase epsilon subunit p12;DNA polymerase II subunit 4;p12;polymerase (DNA-directed), epsilon 4, accessory subunit;polymerase (DNA) epsilon 4, accessory subunit;YHHQ1
- Extra Details:
- POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004]
- Shipping Conditions:
- Blue Ice

