A24506
GTF2IRD1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24506
- Additional Names:
- BEN|CREAM1|GTF2I repeat domain containing 1|GTF2IRD1|GTF3|hMusTRD1alpha1|MUSTRD1|RBAP2|WBS|WBSCR11|WBSCR12
- Application:
- ELISA, WB
- Molecular Weight:
- 130kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKV
- Uniprot:
- Q9UHL9
- Synonyms:
- BEN;binding factor for early enhancer;CREAM1;general transcription factor 3;general transcription factor II-I repeat domain-containing protein 1;general transcription factor III;GTF3;hMusTRD1alpha1;Muscle TFII-I repeat domain-containing protein 1;muscle TFII-I repeat domain-containing protein 1 alpha 1;MUSTRD1;MusTRD1/BEN;RBAP2;slow-muscle-fiber enhancer-binding protein;USE B1-binding protein;WBS;WBSCR11;WBSCR12;Williams-Beuren syndrome chromosomal region 11 protein;williams-Beuren syndrome chromosomal region 12 protein;Williams-Beuren syndrome chromosome region 11
- Extra Details:
- The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

