GTF2IRD1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24506
Additional Names:: BEN|CREAM1|GTF2I repeat domain containing 1|GTF2IRD1|GTF3|hMusTRD1alpha1|MUSTRD1|RBAP2|WBS|WBSCR11|WBSCR12
Application:: ELISA, WB
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKV
Uniprot:: Q9UHL9
Synonyms:: BEN;binding factor for early enhancer;CREAM1;general transcription factor 3;general transcription factor II-I repeat domain-containing protein 1;general transcription factor III;GTF3;hMusTRD1alpha1;Muscle TFII-I repeat domain-containing protein 1;muscle TFII-I repeat domain-containing protein 1 alpha 1;MUSTRD1;MusTRD1/BEN;RBAP2;slow-muscle-fiber enhancer-binding protein;USE B1-binding protein;WBS;WBSCR11;WBSCR12;Williams-Beuren syndrome chromosomal region 11 protein;williams-Beuren syndrome chromosomal region 12 protein;Williams-Beuren syndrome chromosome region 11
Extra Details:: The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice