MAdCAM-1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24489
Additional Names:: MAdCAM-1
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY
Uniprot:: Q61826
Synonyms:: AV211525;cell adhesion molecule 1;MAdCAM-1;mucosal addressin cell adhesion molecule 1
Extra Details:: Predicted to enable integrin binding activity involved in cell-matrix adhesion. Acts upstream of or within keratinocyte differentiation and leukocyte migration. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in eyelid; hair follicle; and hemolymphoid system. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1).