A24485
NAPSA Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24485
- Additional Names:
- KAP|Kdap|NAP1|NAPA|NAPSA|napsin-A|SNAPA
- Application:
- ELISA, WB
- Molecular Weight:
- 38-55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLG
- Uniprot:
- O96009
- Synonyms:
- asp 4;ASP4;aspartyl protease 4;KAP;Kdap;kidney-derived aspartic protease-like protein;NAP1;NAPA;napsin-1;napsin-A;pronapsin A;SNAPA;TA01/TA02
- Extra Details:
- This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.
- Shipping Conditions:
- Blue Ice