CK14 Rabbit polyclonal antibody

Size

POA

SKU:: A24481
Additional Names:: CK14|EBS3|EBS4|K14|keratin 14|KRT14|NFJ
Application:: ELISA, WB, IF, ICC
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Uniprot:: P02533
Synonyms:: CK14;cytokeratin 14;Cytokeratin-14;EBS3;EBS4;K14;keratin 14, type I;Keratin-14;keratin, type I cytoskeletal 14;NFJ
Extra Details:: This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.