A24474
PARVA Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24474
- Additional Names:
- alpha-parvin|CH-ILKBP|MXRA2|PARVA
- Application:
- ELISA, WB
- Molecular Weight:
- 45-50kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKV
- Uniprot:
- Q9NVD7
- Synonyms:
- actopaxin;alpha-parvin;calponin-like integrin-linked kinase-binding protein;CH-ILKBP;matrix-remodeling-associated protein 2;MXRA2
- Extra Details:
- This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
- Shipping Conditions:
- Blue Ice