ZDHHC15 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24473
Additional Names:: DHHC15|MRX91|palmitoyltransferase ZDHHC15|ZDHHC15
Application:: ELISA, WB
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
Uniprot:: Q96MV8
Synonyms:: acyltransferase ZDHHC15;DHHC-15;DHHC15;MRX91;palmitoyltransferase ZDHHC15;zinc finger DHHC domain-containing protein 15;zinc finger DHHC-type containing 15;zinc finger, DHHC domain containing 15
Extra Details:: The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.