A24472
RAP1B Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24472
- Additional Names:
- K-REV|RAL1B|RAP1B|ras-related protein Rap-1b
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 23kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC
- Uniprot:
- P61224
- Synonyms:
- GTP-binding protein smg p21B;K-REV;RAL1B;Ras family small GTP binding protein RAP1B;ras-related protein Rap-1b;RAS-related protein RAP1B;small GTP binding protein
- Extra Details:
- This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9.
- Shipping Conditions:
- Blue Ice

