A24468
GRHL2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24468
- Additional Names:
- BOM|DFNA28|ECTDS|grainyhead-like protein 2 homolog|GRHL2|TFCP2L3
- Application:
- ELISA, WB
- Molecular Weight:
- 71kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
- Uniprot:
- Q6ISB3
- Synonyms:
- BOM;brother of mammalian grainyhead;brother-of-MGR;DFNA28;ECTDS;grainyhead-like 2;grainyhead-like protein 2 homolog;PPCD4;TFCP2L3;transcription factor CP2-like 3
- Extra Details:
- The protein encoded by this gene is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28).
- Shipping Conditions:
- Blue Ice



