A24467
DYRK2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A24467
- Additional Names:
- dual specificity tyrosine-phosphorylation-regulated kinase 2|DYRK2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 66kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
- Uniprot:
- Q92630
- Synonyms:
- dual specificity tyrosine-(Y)-phosphorylation regulated kinase 2;dual specificity tyrosine-phosphorylation-regulated kinase 2
- Extra Details:
- DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert.
- Shipping Conditions:
- Blue Ice