LGR5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24460
Additional Names:: FEX|GPR49|GPR67|GRP49|HG38|LGR5
Application:: ELISA, Flow Cytometry, WB
Molecular Weight:: 102kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTS
Uniprot:: O75473
Synonyms:: FEX;G-protein coupled receptor 49;G-protein coupled receptor 67;G-protein coupled receptor HG38;GPR49;GPR67;GRP49;HG38;leucine-rich repeat-containing G-protein coupled receptor 5;orphan G protein-coupled receptor HG38
Extra Details:: The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.