PGHS-2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A24438
Additional Names:: COX-2|COX2|GRIPGHS|hCox-2|PGG/HS|PGHS-2|PHS-2
Application:: WB
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Uniprot:: P35354
Synonyms:: COX-2;COX2;cyclooxygenase 2;cyclooxygenase 2b;Cyclooxygenase-2;GRIPGHS;hCox-2;PGG/HS;PGH synthase 2;PGHS-2;PHS II;PHS-2;prostaglandin G/H synthase 2;prostaglandin H2 synthase 2;Prostaglandin-endoperoxide synthase 2;prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Extra Details:: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.