Mouse G-CSF Rabbit monoclonal antibody

Size

POA

SKU:: A24423
Additional Names:: Csfg|G-CSF|MGI-IG|Mouse G-CSF
Application:: ELISA, WB
Molecular Weight:: 50-60kDa (Recombinant Protein)
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Uniprot:: P09920
Synonyms:: C17orf33;Csf;CSF3OS;Csfg;filgrastim;G-CS;G-CSF;GCSF;granulocyte colony-stimulating factor;granulocyte-colony stimulating factor;lenograstim;MGI-;MGI-IG;pluripoietin
Extra Details:: Enables granulocyte colony-stimulating factor receptor binding activity. Acts upstream of or within positive regulation of myeloid cell differentiation. Predicted to be located in endocytic vesicle lumen and extracellular region. Predicted to be active in extracellular space. Is expressed in several structures, including brain; dorsal aorta; liver; reproductive system; and yolk sac. Human ortholog(s) of this gene implicated in several diseases, including allergic cutaneous vasculitis; artery disease (multiple); ischemia (multiple); leukemia (multiple); and lung disease (multiple). Orthologous to human CSF3 (colony stimulating factor 3).

Shipping Conditions:: Blue Ice