ABflo[R] 488 Rabbit anti-Human OPN1LW/OPN1MW monoclonal antibody

Size

£243.00

Was £324.00

SKU:: A24370
Additional Names:: CBBM|CBD|CBP|COD5|GCP|GOP|OPN1MW1|RCP|ROP
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIA
Uniprot:: P04000, P04001
Synonyms:: CBBM;CBD;CBP;COD5;cone dystrophy 5 (X-linked);GCP;GOP;green cone photoreceptor pigment;green cone pigment;green-sensitive opsin;long-wave-sensitive opsin 1;medium-wave-sensitive opsin 1;Medium-wave-sensitive opsin 2;medium-wave-sensitive opsin 3;OPN1MW;OPN1MW1;OPN1MW2;opsin 1 (cone pigments), long-wave-sensitive;opsin 1 (cone pigments), medium-wave-sensitive;opsin 1 (cone pigments), medium-wave-sensitive 2;opsin 1 (cone pigments), medium-wave-sensitive 3;Opsin 1 cone pigments medium-wave-sensitive 2;opsin 1 cone pigments medium-wave-sensitive 3;photopigment apoprotein;RCP;red cone opsin;red cone photoreceptor pigment;red-sensitive opsin;ROP
Extra Details:: This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called green cone photopigment or medium-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. The long-wavelength opsin gene and multiple copies of the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of deutanopic colorblindness.

Shipping Conditions:: Blue Ice