Collagen II Rabbit polyclonal antibody

Size

£152.00

SKU:: A24334
Additional Names:: ANFH|AOM|COL11A3|Collagen II|SEDC|STL1
Application:: ELISA, WB, IP
Molecular Weight:: 36 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 0.09% sodium azide. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQ
Uniprot:: P02458
Synonyms:: alpha-1 type II collagen;ANFH;AOM;arthroophthalmopathy, progressive (Stickler syndrome);cartilage collagen;chondrocalcin;COL11A3;collagen alpha-1(II) chain;collagen II, alpha-1 polypeptide;collagen, type II, alpha 1;SEDC;STL1
Extra Details:: This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.