ABflo[R] 488 Rabbit anti-Human CD112/Nectin-2 monoclonal antibody

Size

POA

SKU:: A24327
Additional Names:: CD112|HVEB|nectin-2|NECTIN2|PRR2|PVRL2|PVRR2
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
Uniprot:: Q92692
Synonyms:: CD112;Herpes virus entry mediator B;herpesvirus entry protein B;HVEB;Nectin cell adhesion molecule 2;nectin-2;poliovirus receptor-like 2;poliovirus receptor-related 2 (herpesvirus entry mediator B);Poliovirus receptor-related protein 2;PRR2;PVRL2;PVRR2
Extra Details:: This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.