ABflo[R] 488 Rabbit anti-Human CD303/BDCA-2 monoclonal antibody

Size

POA

SKU:: A24311
Additional Names:: BDCA2|C-type lectin domain family 4 member C|CD303|CLEC4C|CLECSF11|CLECSF7|DLEC|HECL|PRO34150
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
Uniprot:: Q8WTT0
Synonyms:: BDCA-2;BDCA2;Blood dendritic cell antigen 2;blood dendritic cell antigen 2 protein;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11;C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7;C-type lectin domain family 4 member C;C-type lectin superfamily member 7;CD303;CLECSF11;CLECSF7;dendritic cell lectin b;dendritic lectin;DLEC;HECL;PRO34150
Extra Details:: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.

Shipping Conditions:: Blue Ice