ABflo[R] 488 Rabbit anti-Human CD47 monoclonal antibody

Size

POA

SKU:: A24300
Additional Names:: CD47|CD47 molecule|IAP|MER6|OA3
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Uniprot:: Q08722
Synonyms:: antigen identified by monoclonal antibody 1D8;antigenic surface determinant protein OA3;CD47 antigen (Rh-related antigen, integrin-associated signal transducer);CD47 glycoprotein;IAP;integrin associated protein;Integrin-associated protein;integrin-associated signal transducer;leukocyte surface antigen CD47;MER6;OA3;Protein MER6;Rh-related antigen
Extra Details:: This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.

Shipping Conditions:: Blue Ice