A24289
TXNIP Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A24289
- Additional Names:
- ARRDC6|EST01027|HHCPA78|THIF|TXNIP|VDUP1
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DLPLVIGSRSGLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ
- Uniprot:
- Q9H3M7
- Synonyms:
- ARRDC6;EST01027;HHCPA78;THIF;thioredoxin binding protein 2;Thioredoxin-binding protein 2;thioredoxin-interacting protein;upregulated by 1,25-dihydroxyvitamin D-3;VDUP1;vitamin D3 up-regulated protein 1
- Extra Details:
- This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

