SQLE Rabbit polyclonal antibody

Size

£152.00

SKU:: A2428
Additional Names:: SQLE
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 50-64 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKK
Uniprot:: Q14534
Synonyms:: SE;Squalene epoxidase;squalene monooxygenase
Extra Details:: Enables FAD binding activity and squalene monooxygenase activity. Involved in lipid droplet formation; regulation of cell population proliferation; and sterol biosynthetic process. Located in intracellular membrane-bounded organelle. Is integral component of membrane.