A24261
PP2A-B55A Alpha/PR55A Alpha/PPP2R2A Rabbit monoclonal antibody
Size
POA
- SKU:
- A24261
- Additional Names:
- B55A|B55ALPHA|PP2A-B55A Alpha/PR55A Alpha/PPP2R2A|PR52A|PR55A|PR55alpha
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLS
- Uniprot:
- P63151
- Synonyms:
- B55A;B55ALPHA;PP2A subunit B isoform alpha;PP2A subunit B isoform B55-alpha;PP2A subunit B isoform PR55-alpha;PP2A subunit B isoform R2-alpha;PR52A;PR55A;PR55alpha;protein phosphatase 2, regulatory subunit B, alpha;serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
- Extra Details:
- The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B55 subfamily. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice