ABflo[R] 488 Rabbit anti-Human Integrin B Beta5/ITGB5 monoclonal antibody

Size

POA

SKU:: A24246
Additional Names:: integrin beta-5|ITGB5
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS
Uniprot:: P18084
Synonyms:: integrin beta-5;testis secretory sperm-binding protein Li 217p
Extra Details:: I Iotantegrins, heterodimeric trans-membrane matrix receptors, are mainly involved in the signal transduction and attachments to extra cellular matrix (ECM). In ECM they act as a mediator of cell adhesion. In human, at least 18 A Alpha and eight B Beta subunits have been found. ITGB5 (integrin subunit B Beta 5) helps in facilitation of cancer cell migration, anchorage-independent growth and tumor angiogenesis. Integrin is activated by G-protein-coupled receptors, resulting in the phosphorylation of cytoplasmic domain of the B Beta subunit. The coupled A Alpha and B Beta cytoplasmic tails are responsible for maintaining integrin in inactive state.

Shipping Conditions:: Blue Ice