Histone H2B (testis specific) Rabbit monoclonal antibody

Size

POA

SKU:: A24166
Additional Names:: bA317E16.3|H2BFU|HIST1H2BA|Histone H2B (testis specific)?|hTSH2B|STBP|TH2B|TSH2B|TSH2B.1
Application:: ChIP, ELISA, WB, IHC-P, IF, IP
Molecular Weight:: 17kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV
Uniprot:: Q96A08
Synonyms:: bA317E16.3;H2B histone family, member U, (testis-specific);H2BFU;HIST1H2BA;histone 1, H2ba;histone cluster 1 H2B family member a;histone cluster 1, H2ba;histone H2B type 1-A;histone H2B, testis;hTSH2B;STBP;testis-specific histone H2B;TH2B;TSH2B;TSH2B.1
Extra Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element.

Shipping Conditions:: Blue Ice