NSUN2 Rabbit monoclonal antibody

Size

POA

SKU:: A24132
Additional Names:: MISU|MRT5|NSUN2|SAKI|TRM4
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 100 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG
Uniprot:: Q08J23
Synonyms:: 5-methycytoisine methyltransferase;MISU;mRNA cytosine C(5)-methyltransferase;MRT5;myc-induced SUN domain-containing protein;Myc-induced SUN-domain-containing protein;NOL1/NOP2/Sun domain family member 2;NOL1/NOP2/Sun domain family, member 2;NOP2/Sun domain family, member 2;NOP2/Sun RNA methyltransferase family member 2;RNA cytosine C(5)-methyltransferase NSUN2;SAKI;substrate of AIM1/Aurora kinase B;TRM4;tRNA (cytosine-5-)-methyltransferase;tRNA (cytosine-5-)-methyltransferase NSUN2;tRNA (cytosine(34)-C(5))-methyltransferase;tRNA cytosine C(5)-methyltransferase;tRNA methyltransferase 4 homolog
Extra Details:: This gene encodes a methyltransferase that catalyzes the methylation of cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. This modification is necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Shipping Conditions:: Blue Ice