CD9 Rabbit monoclonal antibody

Size

POA

SKU:: A24130
Additional Names:: BTCC-1|CD9|DRAP-27|MIC3|MRP-1|TSPAN-29|TSPAN29
Application:: ELISA, Flow Cytometry, WB, IHC-P, IF, ICC
Molecular Weight:: 23 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Uniprot:: P21926
Synonyms:: 5H9 antigen;antigen CD9;BA-2/p24 antigen;BTCC-1;CD9 antigen;CD9 antigen (p24);cell growth-inhibiting gene 2 protein;DRAP-27;leukocyte antigen MIC3;MIC3;motility related protein-1;Motility-related protein;MRP-1;p24;tetraspanin-29;TSPAN-29;TSPAN29
Extra Details:: This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.

Shipping Conditions:: Blue Ice