A24075
CD95 Rabbit monoclonal antibody
Size
POA
- SKU:
- A24075
- Additional Names:
- APO1|APT1|CD95|lpr|TNFR6|Tnfrsf6
- Application:
- ELISA, Flow Cytometry
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNR
- Uniprot:
- P25446
- Synonyms:
- AI196731;ALPS1A;AP;APO-1;apo-1 antigen;APO-1 cell surface antigen;APO1;apoptosis antigen 1;apoptosis signaling receptor FAS;apoptosis-mediating surface antigen FAS;APT1;CD95;CD95 antigen;Fas (TNF receptor superfamily member);Fas (TNF receptor superfamily, member 6);Fas AMA;Fas antigen;FAS1;FASLG receptor;FASTM;lpr;lymphoproliferation;mutant tumor necrosis receptor superfamily member 6;TNF;TNF receptor superfamily member 6;Tnfr;TNFR6;TNFRSF6;tumor necrosis factor receptor superfamily member 6;tumor necrosis factor receptor superfamily, member 6
- Extra Details:
- CD95, also known as Fas, is a approximately 45 kD type I transmembrane protein in the TNFR superfamily (TNFRSF6). CD95 was expressed in thymus, spleen, liver, heart, lung, ovary and other organs. CD95 binds ligand (FasL) to form a death-inducing signaling complex (DISC) in cells to induce apoptosis. Cd95-induced apoptosis plays an important role in development and in maintaining peripheral tolerance of the immune system.
- Shipping Conditions:
- Blue Ice