[KD Validated] TIFAB Rabbit monoclonal antibody

Size

POA

SKU:: A24024
Application:: ELISA, WB
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
Uniprot:: Q6ZNK6
Synonyms:: TIFA-like protein;TIFA-related protein TIFAB;TRAF-interacting protein with FHA domain-containing protein B;TRAF-interacting protein with forkhead-associated domain, family member B
Extra Details:: TIFAB binds to TIFA (MIM 609028) and inhibits TIFA mediated NF kappa-B (NFKB1; MIM 164011) activation.