[KD Validated] NUR77 Rabbit monoclonal antibody

Size

POA

SKU:: A24016
Additional Names:: [KD Validated] NUR77|GFRP1|HMR|N10|NAK-1|NGFIB|NP10|NUR77|TR3
Application:: ELISA, WB
Molecular Weight:: 64kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
Uniprot:: P22736
Synonyms:: early response protein NAK1;GFRP1;growth factor-inducible nuclear protein N10;HMR;hormone receptor;N10;NAK-1;nerve growth factor IB nuclear receptor variant 1;NGFIB;NP10;nuclear hormone receptor NUR/77;nuclear receptor subfamily 4 group A member 1;NUR77;orphan nuclear receptor HMR;orphan nuclear receptor TR3;ST-59;steroid receptor TR3;testicular receptor 3;TR3;TR3 orphan receptor
Extra Details:: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.