A24007
IL9 Rabbit monoclonal antibody
Size
POA
- SKU:
- A24007
- Additional Names:
- HP40|IL-9|IL9|P40
- Application:
- ELISA, Flow Cytometry, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
- Uniprot:
- P15248
- Synonyms:
- cytokine P40;homolog of mouse T cell and mast cell growth factor 40;HP40;IL-9;interleukin-9;P40;p40 cytokine;p40 T-cell and mast cell growth factor;T-cell growth factor p40
- Extra Details:
- The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
- Shipping Conditions:
- Blue Ice