PKC alpha + beta + gamma Rabbit monoclonal antibody

Size

POA

SKU:: A24003
Additional Names:: AAG6|PKC alpha + beta + gamma|PKC-alpha|PKCA|PKCalpha|PKCI+/-|PRKACA
Application:: ELISA, WB
Molecular Weight:: 78kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKT
Uniprot:: P05129, P05771, P17252, Q02156
Synonyms:: AAG6;aging-associated gene 6;nPKC-epsilon;PKC-A;PKC-alpha;PKC-B;PKC-beta;PKC-gamma;PKCA;PKCalpha;PKCB;PKCbeta;PKCC;PKCE;PKCG;PKCgamma;PKCI(2);PKCI(3);PKCI+/-;PRKACA;PRKCB1;PRKCB2;protein kinase C alpha type;protein kinase C beta type;protein kinase C epsilon type;protein kinase C gamma type;protein kinase C, beta 1 polypeptide;SCA14
Extra Details:: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.

Shipping Conditions:: Blue Ice