SHB Rabbit monoclonal antibody

Size

POA

SKU:: A24000
Additional Names:: bA3J10.2|SHB
Application:: ELISA, WB
Molecular Weight:: 55 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: IWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Uniprot:: Q15464
Synonyms:: bA3J10.2;SH2 domain-containing adapter protein B;SHB (Src homology 2 domain containing) adaptor protein B;SHB adaptor protein (a Src homology 2 protein);Src homology 2 domain containing adaptor protein B
Extra Details:: Enables phosphotyrosine residue binding activity. Predicted to be involved in several processes, including angiogenesis; apoptotic process; and signal transduction. Predicted to act upstream of or within several processes, including hematopoietic stem cell proliferation; negative regulation of oocyte maturation; and positive regulation of immune response. Located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleoplasm.