PLGF Rabbit monoclonal antibody

Size

POA

SKU:: A2400
Additional Names:: D12S1900|PGFL|PIGF|PLGF|PlGF-2|SHGC-10760
Application:: ELISA, WB, IF
Molecular Weight:: 25 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETA
Uniprot:: P49763
Synonyms:: D12S1900;PGFL;PIGF;placenta growth factor;placental growth factor, vascular endothelial growth factor-related protein;PLGF;PlGF-2;SHGC-10760
Extra Details:: Enables growth factor activity. Involved in positive regulation of cell population proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Biomarker of several diseases, including artery disease (multiple); autoimmune disease of musculoskeletal system (multiple); epilepsy (multiple); limited scleroderma; and pancreatic endocrine carcinoma.