[KD Validated] PHF11 Rabbit monoclonal antibody

Size

POA

SKU:: A23994
Additional Names:: [KD Validated] PHF11|APY|BCAP|IGEL|IGER|IGHER|NY-REN-34|NYREN34
Application:: ELISA, WB
Molecular Weight:: 34 kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMS
Uniprot:: Q9UIL8
Synonyms:: APY;BCAP;BRCA1 C-terminus-associated protein;IgE responsiveness (atopic);IGEL;IGER;IGHER;NY-REN-34;NYREN34;PHD finger protein 11;renal carcinoma antigen NY-REN-34
Extra Details:: This gene encodes a protein containing a PHD (plant homeodomain) type zinc finger. This gene has been identified in some studies as a candidate gene for asthma. Naturally-occurring readthrough transcription may occur from the upstream SETDB2 (SET domain bifurcated 2) gene to this locus. Alternative splicing results in multiple transcript variants.