ABflo[R] 594 Rabbit anti-Mouse CD5 monoclonal antibody

Size

POA

SKU:: A23973
Additional Names:: Ly-1|Ly-12|Ly-A|Lyt-1
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
Uniprot:: P13379
Synonyms:: CD5 antigen (p56-62);epididymis secretory sperm binding protein;LEU1;Ly;Ly-;Ly-1;Ly-12;Ly-A;lymphocyte antigen 1;lymphocyte antigen T1/Leu-1;Lyt-;Lyt-1;T-cell surface glycoprotein CD5;T1
Extra Details:: CD5 is a type I transmembrane protein belonging to the scavenger receptor cysteine-enriched (SRCR) family, characterized by the presence of at least one SRCR domain containing 90-110 amino acids. CD5 is expressed in all mature T cells, B-1A subsets of mature B cells, and certain leukemia B cells. It is elevated in regulatory T and B cells (Tregs/Bregs). CD5 expression was also elevated in incompetent T and B cells. Elevated levels of CD5 have also been found in many autoimmune diseases. CD5 binds to T cell receptors (TCR) and negatively regulates T cell activation and differentiation. The expression of CD5 in tumor-infiltrating T lymphocytes was negatively correlated with their antitumor activity. Recently, it has been reported that CD5 binds directly to IL6 and mediates downstream signal transduction. CD5+ B cells promote tumor growth in animal models. Agents targeting CD5 are being actively explored as therapeutic interventions for cancer and other conditions.

Shipping Conditions:: Blue Ice