ABflo[R] 488 Rabbit anti-Mouse CD201/EPCR monoclonal antibody

Size

POA

SKU:: A23968
Additional Names:: Ccca|Ccd41|Epcr
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
Uniprot:: Q64695
Synonyms:: activated protein C receptor;AI325044;APC receptor;Ccc;CCCA;CCD41;CD antigen CD201;CD201 antigen;cell cycle, centrosome-associated protein;centrocyclin;centrosomal protein CCD41;endothelial cell protein C receptor;endothelial protein C receptor;EP;EPCR;protein C receptor, endothelial
Extra Details:: Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst; endocardial tissue; female reproductive system; liver; and vascular element. Orthologous to human PROCR (protein C receptor).