A23957
HSP40 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23957
- Additional Names:
- dnaJ homolog subfamily B member 1|DNAJB1|Hdj1|Hsp40|HSPF1|RSPH16B|Sis1
- Application:
- ELISA, Flow Cytometry, WB
- Molecular Weight:
- 40kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
- Uniprot:
- P25685
- Synonyms:
- DnaJ (Hsp40) homolog, subfamily B, member 1;dnaJ homolog subfamily B member 1;dnaJ protein homolog 1;Hdj1;heat shock 40 kDa protein 1;Hsp40;HSPF1;human DnaJ protein 1;radial spoke 16 homolog B;RSPH16B;Sis1
- Extra Details:
- This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice