A23883
CD3d Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A23883
- Additional Names:
- CD3d|T3d
- Application:
- ELISA, WB
- Molecular Weight:
- 20kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VLPQGSPFKIQVTEYEDKVFVTCNTSVMHLDGTVEGWFAKNKTLNLGKGVLDPRGIYLCNGTEQLAKVVSSVQVHYRMCQNCVELDSGTMAGVIFIDLIAT
- Uniprot:
- P04235
- Synonyms:
- T-cell receptor T3 delta chain;T-cell surface glycoprotein CD3 delta chain;T3d
- Extra Details:
- Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Involved in positive thymic T cell selection. Part of alpha-beta T cell receptor complex. Is expressed in thymus primordium. Human ortholog(s) of this gene implicated in immunodeficiency 19 and severe combined immunodeficiency. Orthologous to human CD3D (CD3d molecule).
- Shipping Conditions:
- Blue Ice