SLC25A21 Rabbit polyclonal antibody

Size

£152.00

SKU:: A23865
Additional Names:: MTDPS18|ODC|ODC1|SLC25A21
Application:: ELISA, WB, IHC-P
Molecular Weight:: 33kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKY
Uniprot:: Q9BQT8
Synonyms:: mitochondrial 2-oxodicarboxylate carrier;MTDPS18;ODC;ODC1;oxodicarboxylate carrier;solute carrier family 25 (mitochondrial oxoadipate carrier), member 21;solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21;Solute carrier family 25 member 21
Extra Details:: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.