A23829
pan 14-3-3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23829
- Additional Names:
- 14-3-3|14-3-3-zeta|1C5|GW128|HEL-S-1|HEL-S-3|HEL-S-93|HEL4|HS1|KCIP-1|pan 14-3-3|POPCHAS|YWHAA|YWHAD
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL
- Uniprot:
- P27348, P31946, P31947, P61981, P62258, P63104, Q04917
- Synonyms:
- 14-3-3;14-3-3 alpha;14-3-3 delta;14-3-3 epsilon;14-3-3 eta;14-3-3 protein beta/alpha;14-3-3 protein epsilon;14-3-3 protein eta;14-3-3 protein gamma;14-3-3 protein sigma;14-3-3 protein T-cell;14-3-3 protein tau;14-3-3 protein theta;14-3-3 protein zeta/delta;14-3-3 protein/cytosolic phospholipase A2;14-3-3 theta;14-3-3 zeta;14-3-3-zeta;14-3-3E;14-3-3GAMMA;1C5;DEE56;EIEE56;epididymis luminal protein 2;epididymis luminal protein 4;epididymis secretory protein Li 1;epididymis secretory protein Li 3;epididymis secretory protein Li 93;epithelial cell marker protein 1;GW128;HEL-S-1;HEL-S-3;HEL-S-93;HEL2;HEL4;HS1;KCIP-1;MDCR;MDS;mitochondrial import stimulation factor L subunit;phospholipase A2;POPCHAS;PPP1R170;protein 1054;Protein AS1;Protein HS1;protein kinase C inhibitor protein 1;protein kinase C inhibitor protein-1;protein phosphatase 1, regulatory subunit 170;protein, theta;Stratifin;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alpha polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide;tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide;tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide;YWHA1;YWHAA;YWHAD;YWHAS
- Extra Details:
- This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.This gene encodes a protein belonging to the 14-3-3 family of proteins, members of which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals. The encoded protein has been shown to interact with RAF1 and CDC25 phosphatases, suggesting that it may play a role in linking mitogenic signaling and the cell cycle machinery. Two transcript variants, which encode the same protein, have been identified for this gene.
- Shipping Conditions:
- Blue Ice