ABflo[R] 488 Rabbit anti-Human CD119/IFNGR1 monoclonal antibody

Size

POA

SKU:: A23816
Additional Names:: CD119|IFNGR|IFNGR1|IMD27A|IMD27B|interferon gamma receptor 1
Application:: Flow Cytometry
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
Uniprot:: P15260
Synonyms:: antiviral protein, type 2;AVP, type 2;CD119;CD119 antigen;CDw119;IFN-gamma receptor 1;IFN-gamma-R-alpha;IFN-gamma-R1;IFNGR;IMD27A;IMD27B;immune interferon receptor 1;interferon gamma receptor 1;Interferon gamma receptor alpha-chain;interferon-gamma receptor alpha chain
Extra Details:: This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.