A23794
DDX3X/DDX3Y Rabbit monoclonal antibody
Size
POA
- SKU:
- A23794
- Additional Names:
- CAP-Rf|DBX|DBY|DDX14|DDX3|DDX3X/DDX3Y|HLP2|MRX102|MRXSSB
- Application:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 75 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRY
- Uniprot:
- O00571, O15523
- Synonyms:
- ATP-dependent RNA helicase DDX3X;ATP-dependent RNA helicase DDX3Y;CAP-Rf;DBX;DBY;DDX14;DDX3;DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked;DEAD (Asp-Glu-Ala-Asp) box helicase 3, Y-linked;DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked;DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked;DEAD box protein 3, X-chromosomal;DEAD box protein 3, Y-chromosomal;DEAD box, X isoform;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome;DEAD/H box-3;helicase-like protein 2;HLP2;MRX102;MRXSSB
- Extra Details:
- The protein encoded by this gene is a member of the large DEAD-box protein family, that is defined by the presence of the conserved Asp-Glu-Ala-Asp (DEAD) motif, and has ATP-dependent RNA helicase activity. This protein has been reported to display a high level of RNA-independent ATPase activity, and unlike most DEAD-box helicases, the ATPase activity is thought to be stimulated by both RNA and DNA. This protein has multiple conserved domains and is thought to play roles in both the nucleus and cytoplasm. Nuclear roles include transcriptional regulation, mRNP assembly, pre-mRNA splicing, and mRNA export. In the cytoplasm, this protein is thought to be involved in translation, cellular signaling, and viral replication. Misregulation of this gene has been implicated in tumorigenesis. This gene has a paralog located in the nonrecombining region of the Y chromosome. Pseudogenes sharing similarity to both this gene and the DDX3Y paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants.The protein encoded by this gene is a member of the DEAD-box RNA helicase family, characterized by nine conserved motifs, included the conserved Asp-Glu-Ala-Asp (DEAD) motif. These motifs are thought to be involved in ATP binding, hydrolysis, RNA binding, and in the formation of intramolecular interactions. This protein shares high similarity to DDX3X, on the X chromosome, but a deletion of this gene is not complemented by DDX3X. Mutations in this gene result in male infertility, a reduction in germ cell numbers, and can result in Sertoli-cell only sydrome. Pseudogenes sharing similarity to both this gene and the DDX3X paralog are found on chromosome 4 and the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice