A23787
CD109 Rabbit monoclonal antibody
Size
POA
- SKU:
- A23787
- Additional Names:
- CD109|CD109 antigen|CPAMD7|p180|r150
- Application:
- ELISA, WB
- Molecular Weight:
- 190kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNITKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKS
- Uniprot:
- Q6YHK3
- Synonyms:
- 150 kDa TGF-beta-1-binding protein;activated T-cell marker CD109;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 7;CD109 antigen;CDK8 protein kinase;cell division protein kinase 8;CPAMD7;cyclin-dependent kinase 8;Gov platelet alloantigens;IDDHBA;K35;mediator complex subunit CDK8;mediator of RNA polymerase II transcription subunit CDK8;p180;platelet-specific Gov antigen;protein kinase K35;r150
- Extra Details:
- This gene encodes a glycosyl phosphatidylinositol (GPI)-linked glycoprotein that localizes to the surface of platelets, activated T-cells, and endothelial cells. The protein binds to and negatively regulates signalling by transforming growth factor beta (TGF-beta). Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice