CD244 Rabbit monoclonal antibody

Size

POA

SKU:: A23783
Additional Names:: 2B4|CD244|CD244 molecule|NAIL|NKR2B4|Nmrk|SLAMF4
Application:: ELISA, Flow Cytometry, WB
Molecular Weight:: 70-120kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA
Uniprot:: Q9BZW8
Synonyms:: 2B4;CD244 molecule, natural killer cell receptor 2B4;h2B4;NAIL;natural killer cell receptor 2B4;NK cell activation inducing ligand NAIL;NK cell activation-inducing ligand;NK cell type I receptor protein 2B4;NKR2B4;Nmrk;signaling lymphocytic activation molecule 4;SLAM family member 4;SLAMF4
Extra Details:: This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.