A23764
EGFR Rabbit monoclonal antibody
Size
POA
- SKU:
- A23764
- Additional Names:
- EGFR|epidermal growth factor receptor|ERBB|ERBB1|HER1|mENA|NISBD2|PIG61
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 175 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVS
- Uniprot:
- P00533
- Synonyms:
- avian erythroblastic leukemia viral (v-erb-b) oncogene homolog;cell growth inhibiting protein 40;cell proliferation-inducing protein 61;epidermal growth factor receptor;epidermal growth factor receptor tyrosine kinase domain;erb-b2 receptor tyrosine kinase 1;ERBB;ERBB1;ERRP;HER1;mENA;NISBD2;PIG61;proto-oncogene c-ErbB-1;receptor tyrosine-protein kinase erbB-1
- Extra Details:
- The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer.
- Shipping Conditions:
- Blue Ice